PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family HRT-like
Protein Properties Length: 478aa    MW: 53930.7 Da    PI: 9.9596
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27240.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like581.6e-18275305131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGvile+G +C+r+PvkgRKRC eHKG+Ri
  KFK27240.1 275 VCGVILENGGFCNRSPVKGRKRCIEHKGQRI 305
                 7*****************************7 PP

2HRT-like53.54.1e-17329359131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGvil +  +C+++Pv+gRKRCeeHKGmRi
  KFK27240.1 329 MCGVILPNMEPCNKSPVPGRKRCEEHKGMRI 359
                 6*****************************7 PP

3HRT-like24.35.2e-08398425229
    HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGm 29 
                 C +++++G +C+r+  kg K C++HK++
  KFK27240.1 398 CEATTKNGLPCTRSSPKGSKKCWQHKDK 425
                 99************************85 PP

4HRT-like54.61.8e-17445474231
    HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 CGv+l +G +C+r+PvkgRKRC+eHKGmRi
  KFK27240.1 445 CGVKLCNGLICERSPVKGRKRCQEHKGMRI 474
                 *****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MDFGDGVCIA VVPTMFKRED YKRTKHDAVF SKWKVLIGPK DWEDFKNGKD GVGRYRVQNL  60
PRKSYPGLYE LGVAVIDQDQ GRKLDSDIVL AAYLGQAESV RSRLQRYGRS GAHLRNVNYF  120
NDCETIDSLD NKVVTTGLFE AIFSKEGSVV YRWAPMGSKR EAEATEGMLL STFDYAWNKG  180
SNGERRQVDL LKKLGDRGFM SKRKSGISQV LFPFLRKQVG IKIKGEKHVL KQESKVSYDV  240
HEGKKSSSFL ASIFKLSRSR PQSFSDRFDE IGGSVCGVIL ENGGFCNRSP VKGRKRCIEH  300
KGQRICCVSV EKQQPLKPEV HDHKDSDVMC GVILPNMEPC NKSPVPGRKR CEEHKGMRIN  360
AFLFLFNRTD REKTVKDEKS NPESRTKINE EETTTRFCEA TTKNGLPCTR SSPKGSKKCW  420
QHKDKTSGDN LPENVHTVTG VHVACGVKLC NGLICERSPV KGRKRCQEHK GMRITSSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866167.10.0hypothetical protein ARALYDRAFT_918835
SwissprotF4K9330.0ET2_ARATH; Protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLA0A087GBI80.0A0A087GBI8_ARAAL; Uncharacterized protein
STRINGscaffold_802235.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.10.0effector of transcription2